PDB entry 1bk4

View 1bk4 on RCSB PDB site
Description: crystal structure of rabbit liver fructose-1,6-bisphosphatase at 2.3 angstrom resolution
Class: hydrolase
Keywords: bisphosphatase, hydrolase
Deposited on 1998-07-14, released 1998-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (fructose-1,6-bisphosphatase)
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bk4a_
  • Heterogens: MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bk4A (A:)
    adkapfdtdistmtrfvmeegrkaggtgemtqllnslctavkaistavrkagiahlygia
    gstnvtgdqvkkldvlsndlvmnmlkssfatcvlvseedknaiivepekrgkyvvcfdpl
    dgssnidclvsigtifgiyrkkstdepstkdalqpgrnlvaagyalygsatmlvlaggsg
    vnsfmldpaigefilvdknvkikkkgniyslnegyakdfdpavteyiqkkkfppdnsspy
    garyvgsmvadvhrtlvyggiflypankkspdgklrllyecnpmafimekaggmattgke
    aildivptdihqrapvilgspddvqefleiykkhavk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bk4A (A:)
    fdtdistmtrfvmeegrkaggtgemtqllnslctavkaistavrkagikldvlsndlvmn
    mlkssfatcvlvseedknaiivepekrgkyvvcfdpldgssnidclvsigtifgiyrkks
    tdepstkdalqpgrnlvaagyalygsatmlvlaggsgvnsfmldpaigefilvdknvkik
    kkgniyslnegyakdfdpavteyiqkkkfppdnsspygaryvgsmvadvhrtlvyggifl
    ypankkspdgklrllyecnpmafimekaggmattgkeaildivptdihqrapvilgspdd
    vqefleiykkhavk