PDB entry 1bk2

View 1bk2 on RCSB PDB site
Description: a-spectrin sh3 domain d48g mutant
Class: sh3-domain
Keywords: sh3-domain, cytoskeleton, calmodulin-binding, actin-binding
Deposited on 1998-07-14, released 1999-02-16
The last revision prior to the SCOP 1.75 freeze date was dated 1999-02-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.228
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: a-spectrin
  Species: GALLUS GALLUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07751 (0-56)
    • engineered (42)
  Domains in SCOP 1.75: d1bk2a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bk2A (A:)
  kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevngrqgfvpaayvkkld