PDB entry 1bk2

View 1bk2 on RCSB PDB site
Description: a-spectrin sh3 domain d48g mutant
Deposited on 1998-07-14, released 1999-02-16
The last revision prior to the SCOP 1.69 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.228
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1bk2__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bk2_ (-)
    kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevngrqgfvpaayvkkld