PDB entry 1bk2

View 1bk2 on RCSB PDB site
Description: a-spectrin sh3 domain d48g mutant
Class: sh3-domain
Keywords: sh3-domain, cytoskeleton, calmodulin-binding, actin-binding
Deposited on 1998-07-14, released 1999-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.228
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: a-spectrin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07751 (0-56)
      • engineered (42)
    Domains in SCOPe 2.07: d1bk2a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bk2A (A:)
    kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevngrqgfvpaayvkkld