PDB entry 1bk1

View 1bk1 on RCSB PDB site
Description: endo-1,4-beta-xylanase c
Class: hydrolase
Keywords: hydrolase, xylan degradation, glycosidase, signal
Deposited on 1998-07-14, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-b-xylanase c
    Species: Aspergillus kawachii [TaxId:40384]
    Gene: XYNC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33557
      • conflict (14)
      • conflict (52)
    Domains in SCOPe 2.07: d1bk1a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bk1A (A:)
    saginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysa
    sgsssylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtneps
    itgtstftqyfsvrestrtsgtvtvanhfnfwaqhgfgnsdfnyqvmaveawsgagsasv
    tiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bk1A (A:)
    aginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysas
    gsssylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtnepsi
    tgtstftqyfsvrestrtsgtvtvanhfnfwaqhgfgnsdfnyqvmaveawsgagsasvt
    is