PDB entry 1bjy

View 1bjy on RCSB PDB site
Description:
Deposited on 1998-06-29, released 1999-01-13
The last revision prior to the SCOP 1.55 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.203
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1bjya1, d1bjya2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1bjyb1, d1bjyb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bjyA (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
    geqaflhgleslirgfevqltallqiv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bjyB (B:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
    geqaflhgleslirgfevqltallqiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bjyB (B:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaalnlppllrealqimdsddgeqaflhgl
    eslirgfevqltallqiv