PDB entry 1bjy

View 1bjy on RCSB PDB site
Description: tetracycline chelated mg2+-ion initiates helix unwinding for tet repressor induction
Class: transcription regulation
Keywords: transcription regulation, DNA-binding protein, hth-motif
Deposited on 1998-06-29, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.203
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetracycline repressor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bjya3, d1bjya4, d1bjya5
  • Chain 'B':
    Compound: tetracycline repressor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bjyb3, d1bjyb4, d1bjyb5
  • Heterogens: MG, CTC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bjyA (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
    geqaflhgleslirgfevqltallqiv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bjyB (B:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
    geqaflhgleslirgfevqltallqiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bjyB (B:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaalnlppllrealqimdsddgeqaflhgl
    eslirgfevqltallqiv