PDB entry 1bjt

View 1bjt on RCSB PDB site
Description: topoisomerase II residues 409-1201
Class: topoisomerase
Keywords: topoisomerase, quaternary change, DNA-binding, DNA topology
Deposited on 1998-06-29, released 1999-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.227
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: topoisomerase II
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06786
      • conflict (138)
    Domains in SCOPe 2.07: d1bjta_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bjtA (A:)
    enalkksdgtrksritnypkledankagtkegykctlvltegdsalslavaglavvgrdy
    ygcyplrgkmlnvreasadqilknaeiqaikkimglqhrkkyedtkslryghlmimtdqd
    hdgshikgliinflessflglldiqgfllefitpiikvsitkptkntiafynmpdyekwr
    eeeshkftwkqkyykglgtslaqevreyfsnldrhlkifhslqgndkdyidlafskkkad
    drkewlrqyepgtvldptlkeipisdfinkelilfsladnirsipnvldgfkpgqrkvly
    gcfkknlkselkvaqlapyvsectayhhgeqslaqtiiglaqnfvgsnniylllpngafg
    tratggkdaaaaryiytelnkltrkifhpaddplykyiqedektvepewylpilpmilvn
    gaegigtgwstyippfnpleiiknirhlmndeeleqmhpwfrgwtgtieeieplryrmyg
    rieqigdnvleitelpartwtstikeylllglsgndkikpwikdmeeqhddnikfiitls
    peemaktrkigfyerfklispislmnmvafdphgkikkynsvneilsefyyvrleyyqkr
    kdhmserlqwevekysfqvkfikmiiekeltvtnkprnaiiqelenlgfprfnkegkpyy
    gspndeiaeqindvkgatsdeedeesshedtenvingpeelygtyeyllgmriwsltker
    yqkllkqkqeketelenllklsakdiwntdlkafevgyqeflqrdaearggnvpnkgskt
    kgkgkrklvdded
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bjtA (A:)
    rksritnypkledankagtkegykctlvltegdsalslavaglavvgrdyygcyplrgkm
    lnvrealknaeiqaikkimglqhrkkyedtkslryghlmimtdshikgliinflessflg
    lldiqgfllefitpiikvsitkptkntiafynmpdyekwreeeshkftwkqkyykglgts
    laqevreyfsnldrhlkifhslqwlrqyepfinkelilfsladnirsipnvldgfkpgqr
    kvlygcfkknlkselkvaqlapyvsectayhhgeqslaqtiiglaqnfvgsnniylllpn
    gafgtratggkdaaaaryiytelnkltrkifhpaddplykyiqedektvepewylpilpm
    ilvngaegigtgwstyippfnpleiiknirhlmndeeleqmhpwfrgwtgtieeieplry
    rmygrieqigdnvleitelpartwtstikeylllglsgndkikpwikdmeeqhddnikfi
    itlspeemaktrkigfyerfklispislmnmvafdphgkikkynsvneilsefyyvrley
    yqkrkdhmserlqwevekysfqvkfikmiiekeltvtnkprnaiiqelenlgfprfnkeg
    kpyygspeelygtyeyllgmriwsltkeryqkllkqkqeketelenllklsakdiwntdl
    kafevgyqeflqrdaearg