PDB entry 1bjq

View 1bjq on RCSB PDB site
Description: the dolichos biflorus seed lectin in complex with adenine
Class: glycoprotein
Keywords: glycoprotein, lectin, adenine, quaternary structure, legume lectin
Deposited on 1998-06-26, released 1998-12-30
The last revision prior to the SCOP 1.73 freeze date was dated 1999-02-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.219
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Dolichos biflorus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05045 (0-252)
      • conflict (126)
    Domains in SCOP 1.73: d1bjqa_
  • Chain 'B':
    Compound: lectin
    Species: Dolichos biflorus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05045 (0-252)
      • conflict (126)
    Domains in SCOP 1.73: d1bjqb_
  • Chain 'C':
    Compound: lectin
    Species: Dolichos biflorus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05045 (0-End)
      • conflict (126)
    Domains in SCOP 1.73: d1bjqc_
  • Chain 'D':
    Compound: lectin
    Species: Dolichos biflorus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05045 (0-End)
      • conflict (126)
    Domains in SCOP 1.73: d1bjqd_
  • Chain 'E':
    Compound: lectin
    Species: Dolichos biflorus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05045 (0-End)
      • conflict (126)
    Domains in SCOP 1.73: d1bjqe_
  • Chain 'F':
    Compound: lectin
    Species: Dolichos biflorus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05045 (0-End)
      • conflict (126)
    Domains in SCOP 1.73: d1bjqf_
  • Chain 'G':
    Compound: lectin
    Species: Dolichos biflorus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05045 (0-252)
      • conflict (126)
    Domains in SCOP 1.73: d1bjqg_
  • Chain 'H':
    Compound: lectin
    Species: Dolichos biflorus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05045 (0-252)
      • conflict (126)
    Domains in SCOP 1.73: d1bjqh_
  • Heterogens: CA, MN, ADE

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bjqA (A:)
    aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
    tgavaswatsftvkisapskasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtv
    avefdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslv
    hpsrrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpddstae
    pldlasylvrnvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bjqA (A:)
    aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
    tgavaswatsftvkisapasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtvav
    efdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslvhp
    srrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpddstaepl
    dlasylvrnvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bjqB (B:)
    aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
    tgavaswatsftvkisapskasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtv
    avefdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslv
    hpsrrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpddstae
    pldlasylvrnvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bjqC (C:)
    aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
    tgavaswatsftvkisapskasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtv
    avefdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslv
    hpsrrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpddstae
    pldlasylvrnvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bjqC (C:)
    aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
    tgavaswatsftvkisapasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtvav
    efdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslvhp
    srrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1bjqD (D:)
    aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
    tgavaswatsftvkisapskasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtv
    avefdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslv
    hpsrrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpddstae
    pldlasylvrnvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bjqD (D:)
    aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
    tgavaswatsftvkisapasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtvav
    efdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslvhp
    srrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1bjqE (E:)
    aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
    tgavaswatsftvkisapskasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtv
    avefdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslv
    hpsrrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpddstae
    pldlasylvrnvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bjqE (E:)
    aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
    tgavaswatsftvkisapasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtvav
    efdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslvhp
    srrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1bjqF (F:)
    aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
    tgavaswatsftvkisapskasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtv
    avefdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslv
    hpsrrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpddstae
    pldlasylvrnvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bjqF (F:)
    aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
    tgavaswatsftvkisapasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtvav
    efdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslvhp
    srrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpd
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1bjqG (G:)
    aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
    tgavaswatsftvkisapskasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtv
    avefdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslv
    hpsrrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpddstae
    pldlasylvrnvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bjqG (G:)
    aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
    tgavaswatsftvkisapasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtvav
    efdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslvhp
    srrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpddstaepl
    dlasylvrnvl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bjqH (H:)
    aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
    tgavaswatsftvkisapskasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtv
    avefdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslv
    hpsrrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpddstae
    pldlasylvrnvl