PDB entry 1bjp

View 1bjp on RCSB PDB site
Description: crystal structure of 4-oxalocrotonate tautomerase inactivated by 2-oxo-3-pentynoate at 2.4 angstroms resolution
Class: isomerase
Keywords: tautomerase, isomerase, microbial biodegradation
Deposited on 1998-06-26, released 1998-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.206
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-oxalocrotonate tautomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: XYLH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bjpa_
  • Chain 'B':
    Compound: 4-oxalocrotonate tautomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: XYLH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bjpb_
  • Chain 'C':
    Compound: 4-oxalocrotonate tautomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: XYLH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bjpc_
  • Chain 'D':
    Compound: 4-oxalocrotonate tautomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: XYLH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bjpd_
  • Chain 'E':
    Compound: 4-oxalocrotonate tautomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: XYLH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bjpe_
  • Heterogens: OXP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bjpA (A:)
    piaqihilegrsdeqketlirevseaisrsldapltsvrviitemakghfgiggelaskv
    rr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bjpB (B:)
    piaqihilegrsdeqketlirevseaisrsldapltsvrviitemakghfgiggelaskv
    rr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bjpC (C:)
    piaqihilegrsdeqketlirevseaisrsldapltsvrviitemakghfgiggelaskv
    rr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bjpC (C:)
    piaqihilegrsdeqketlirevseaisrsldapltsvrviitemakghfgiggelas
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1bjpD (D:)
    piaqihilegrsdeqketlirevseaisrsldapltsvrviitemakghfgiggelaskv
    rr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bjpD (D:)
    piaqihilegrsdeqketlirevseaisrsldapltsvrviitemakghfgiggelaskv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bjpE (E:)
    piaqihilegrsdeqketlirevseaisrsldapltsvrviitemakghfgiggelaskv
    rr