PDB entry 1bjo

View 1bjo on RCSB PDB site
Description: the structure of phosphoserine aminotransferase from e. coli in complex with alpha-methyl-l-glutamate
Deposited on 1998-06-25, released 1998-11-04
The last revision prior to the SCOP 1.55 freeze date was dated 1998-12-02, with a file datestamp of 1998-12-02.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.185
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1bjoa_
  • Chain 'B':
    Domains in SCOP 1.55: d1bjob_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bjoA (A:)
    qifnfssgpamlpaevlkqaqqelrdwnglgtsvmevshrgkefiqvaeeaekdfrdlln
    vpsnykvlfchgggrgqfaavplnilgdkttadyvdagywaasaikeakkyctpnvfdak
    vtvdglravkpmrewqlsdnaaymhycpnetidgiaidetpdfgadvvvaadfsstilsr
    pidvsrygviyagaqknigpagltivivredllgkaniacpsildysilndngsmfntpp
    tfawylsglvfkwlkanggvaemdkinqqkaellygvidnsdfyrndvakrnrsrmnvpf
    qladsaldklfleesfaaglhalkghrvvggmrasiynamplegvkaltdfmveferrhg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bjoB (B:)
    qifnfssgpamlpaevlkqaqqelrdwnglgtsvmevshrgkefiqvaeeaekdfrdlln
    vpsnykvlfchgggrgqfaavplnilgdkttadyvdagywaasaikeakkyctpnvfdak
    vtvdglravkpmrewqlsdnaaymhycpnetidgiaidetpdfgadvvvaadfsstilsr
    pidvsrygviyagaqknigpagltivivredllgkaniacpsildysilndngsmfntpp
    tfawylsglvfkwlkanggvaemdkinqqkaellygvidnsdfyrndvakrnrsrmnvpf
    qladsaldklfleesfaaglhalkghrvvggmrasiynamplegvkaltdfmveferrhg