PDB entry 1bjo

View 1bjo on RCSB PDB site
Description: the structure of phosphoserine aminotransferase from e. coli in complex with alpha-methyl-l-glutamate
Class: aminotransferase
Keywords: aminotransferase, l-serine biosynthesis
Deposited on 1998-06-25, released 1998-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoserine aminotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: SERC
    Database cross-references and differences (RAF-indexed):
    • PIR S28806 (0-359)
    Domains in SCOPe 2.08: d1bjoa_
  • Chain 'B':
    Compound: phosphoserine aminotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: SERC
    Database cross-references and differences (RAF-indexed):
    • PIR S28806 (0-359)
      • conflict (195)
    Domains in SCOPe 2.08: d1bjob_
  • Heterogens: PLP, GAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bjoA (A:)
    qifnfssgpamlpaevlkqaqqelrdwnglgtsvmevshrgkefiqvaeeaekdfrdlln
    vpsnykvlfchgggrgqfaavplnilgdkttadyvdagywaasaikeakkyctpnvfdak
    vtvdglravkpmrewqlsdnaaymhycpnetidgiaidetpdfgadvvvaadfsstilsr
    pidvsrygviyagaqknigpagltivivredllgkaniacpsildysilndngsmfntpp
    tfawylsglvfkwlkanggvaemdkinqqkaellygvidnsdfyrndvakrnrsrmnvpf
    qladsaldklfleesfaaglhalkghrvvggmrasiynamplegvkaltdfmveferrhg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bjoB (B:)
    qifnfssgpamlpaevlkqaqqelrdwnglgtsvmevshrgkefiqvaeeaekdfrdlln
    vpsnykvlfchgggrgqfaavplnilgdkttadyvdagywaasaikeakkyctpnvfdak
    vtvdglravkpmrewqlsdnaaymhycpnetidgiaidetpdfgadvvvaadfsstilsr
    pidvsrygviyagaqknigpagltivivredllgkaniacpsildysilndngsmfntpp
    tfawylsglvfkwlkanggvaemdkinqqkaellygvidnsdfyrndvakrnrsrmnvpf
    qladsaldklfleesfaaglhalkghrvvggmrasiynamplegvkaltdfmveferrhg