PDB entry 1bjl

View 1bjl on RCSB PDB site
Description: novel arrangement of immunoglobin variable domains: x-ray crystallographic analysis of the lambda-*chain dimer bence-*jones protein loc
Deposited on 1991-03-11, released 1992-01-15
The last revision was dated 1992-07-15, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    no info in PDB for this chain
  • Chain '2':
    no info in PDB for this chain

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain '1':
    Sequence, based on SEQRES records:
    >1bjl1 (1:)
    esvltqppsasgtpgqrvtiscsgsssnigetnsvswyqhlpgtapklliyednsrasgv
    sdrfsasksgtsaslaisglqpedetdyycaawddsldvavfgtgtkvtvlgqpkanptv
    tlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records):
    >1bjl1 (1:)
    esvltqppsasgtpgqrvtiscsgsssnigensvswyqhlpgtapklliyednsrasgvs
    drfsasksgtsaslaisglqpedetdyycaawddsldvavfgtgtkvtvlgqpkanptvt
    lfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

  • Chain '2':
    Sequence, based on SEQRES records:
    >1bjl2 (2:)
    esvltqppsasgtpgqrvtiscsgsssnigetnsvswyqhlpgtapklliyednsrasgv
    sdrfsasksgtsaslaisglqpedetdyycaawddsldvavfgtgtkvtvlgqpkanptv
    tlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records):
    >1bjl2 (2:)
    esvltqppsasgtpgqrvtiscsgsssnigensvswyqhlpgtapklliyednsrasgvs
    drfsasksgtsaslaisglqpedetdyycaawddsldvavfgtgtkvtvlgqpkanptvt
    lfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs