PDB entry 1bje

View 1bje on RCSB PDB site
Description: h64t variant of myoglobin (horse heart) recombinant wild-type complexed with azide
Deposited on 1997-10-18, released 1998-01-28
The last revision prior to the SCOP 1.55 freeze date was dated 1998-01-28, with a file datestamp of 1998-01-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.178
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1bje__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bje_ (-)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkktgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfqg