PDB entry 1bja

View 1bja on RCSB PDB site
Description: activation domain of the phage t4 transcription factor mota
Class: activation domain
Keywords: activation domain, phage t4, middle mode transcription, alpha helical structure, transcription regulation
Deposited on 1998-06-23, released 1998-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.208
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription regulatory protein mota
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: MOTA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bjaa_
  • Chain 'B':
    Compound: transcription regulatory protein mota
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: MOTA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bjab_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bjaA (A:)
    skvtyiikasndvlnektatilitiakkdfitaaevrevhpdlgnavvnsnigvlikkgl
    veksgdgliitgeaqdiisnaatlyaqenapellk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bjaB (B:)
    skvtyiikasndvlnektatilitiakkdfitaaevrevhpdlgnavvnsnigvlikkgl
    veksgdgliitgeaqdiisnaatlyaqenapellk