PDB entry 1bja

View 1bja on RCSB PDB site
Description: activation domain of the phage t4 transcription factor mota
Class: activation domain
Keywords: activation domain, phage t4, middle mode transcription, alpha helical structure, transcription regulation
Deposited on 1998-06-23, released 1998-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.208
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: transcription regulatory protein mota
  Species: Enterobacteria phage T4 [TaxId:10665]
  Gene: MOTA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22915 (0-94)
  Domains in SCOPe 2.08: d1bjaa_
• Chain 'B':
  Compound: transcription regulatory protein mota
  Species: Enterobacteria phage T4 [TaxId:10665]
  Gene: MOTA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22915 (0-94)
  Domains in SCOPe 2.08: d1bjab_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bjaA (A:)
  skvtyiikasndvlnektatilitiakkdfitaaevrevhpdlgnavvnsnigvlikkgl
  veksgdgliitgeaqdiisnaatlyaqenapellk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bjaB (B:)
  skvtyiikasndvlnektatilitiakkdfitaaevrevhpdlgnavvnsnigvlikkgl
  veksgdgliitgeaqdiisnaatlyaqenapellk