PDB entry 1bj8

View 1bj8 on RCSB PDB site
Description: third n-terminal domain of gp130, nmr, minimized average structure
Class: receptor
Keywords: receptor, signal transducer of il-6 type cytokines, third n-terminal domain, transmembrane, glycoprotein
Deposited on 1998-07-02, released 1999-01-13
The last revision prior to the SCOP 1.75 freeze date was dated 1999-01-13, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gp130
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1bj8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bj8A (A:)
mdkvkpnpphnlsvinseelssilkltwtnpsiksviilkyniqyrtkdastwsqipped
tastrssftvqdlkpfteyvfrircmkedgkgywsdwseeasgityedr