PDB entry 1bj8

View 1bj8 on RCSB PDB site
Description: third n-terminal domain of gp130, nmr, minimized average structure
Class: receptor
Keywords: receptor, signal transducer of il-6 type cytokines, third n-terminal domain, transmembrane, glycoprotein
Deposited on 1998-07-02, released 1999-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: gp130
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40189 (2-108)
  Domains in SCOPe 2.08: d1bj8a1, d1bj8a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bj8A (A:)
  mdkvkpnpphnlsvinseelssilkltwtnpsiksviilkyniqyrtkdastwsqipped
  tastrssftvqdlkpfteyvfrircmkedgkgywsdwseeasgityedr