PDB entry 1bj7

View 1bj7 on RCSB PDB site
Description: bovine lipocalin allergen bos d 2
Class: allergen
Keywords: allergen, lipocalin
Deposited on 1998-07-02, released 1999-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.184
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d 2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bj7a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bj7A (A:)
    qetpaeidpskipgewriiyaaadnkdkiveggplrnyyrriecindceslsitfylkdq
    gtcllltevakrqegyvyvlefygtntlevihvsenmlvtyvenydgeritkmteglakg
    tsftpeelekyqqlnsergvpnenienliktdncpp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bj7A (A:)
    idpskipgewriiyaaadnkdkiveggplrnyyrriecindceslsitfylkdqgtclll
    tevakrqegyvyvlefygtntlevihvsenmlvtyvenydgeritkmteglakgtsftpe
    elekyqqlnsergvpnenienliktdncpp