PDB entry 1bj6

View 1bj6 on RCSB PDB site
Description: 1h nmr of (12-53) ncp7/d(acgcc) complex, 10 structures
Deposited on 1998-07-03, released 1999-02-02
The last revision prior to the SCOP 1.55 freeze date was dated 1999-03-23, with a file datestamp of 1999-03-23.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1bj6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bj6A (A:)
    nvkcfncgkeghtarncraprkkgcwkcgkeghqmkdcterq