PDB entry 1bj6

View 1bj6 on RCSB PDB site
Description: 1h nmr of (12-53) ncp7/d(acgcc) complex, 10 structures
Class: Viral protein/DNA
Keywords: COMPLEX (NUCLEOCAPSID PROTEIN/DNA), NUCLEIC ACID, RETROVIRUS, VIRUS MORPHOGENESIS, ZINC FINGER, Viral protein/DNA COMPLEX
Deposited on 1998-07-03, released 1999-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleocapsid protein 7
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bj6a_
  • Chain 'D':
    Compound: DNA (5'-d(*ap*cp*gp*cp*c)-3')
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bj6A (A:)
    nvkcfncgkeghtarncraprkkgcwkcgkeghqmkdcterq
    

  • Chain 'D':
    No sequence available.