PDB entry 1bj4

View 1bj4 on RCSB PDB site
Description: recombinant serine hydroxymethyltransferase (human)
Class: transferase
Keywords: transferase, metabolic role, pyridoxal 5'-phosphate
Deposited on 1998-07-02, released 1999-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (serine hydroxymethyltransferase)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bj4a_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bj4A (A:)
    dadlwsshdamlaqplkdsdvevyniikkesnrqrvgleliasenfasravlealgscln
    nkysegypgqryyggtefideletlcqkralqaykldpqcwgvnvqpysgspanfavyta
    lvephgrimgldlpdgghlthgfmtdkkkisatsiffesmpykvnpdtgyinydqleena
    rlfhpkliiagtscysrnleyarlrkiadengaylmadmahisglvaagvvpspfehchv
    vtttthktlrgcragmifyrkgvksvdpatgkeilynleslinsavfpglqggphnhaia
    gvavalkqamtlefkvyqhqvvancralsealtelgykivtggsdnhlilvdlrskgtdg
    graekvleacsiacnkntcpgdrsalrpsglrlgtpaltsrgllekdfqkvahfihrgie
    ltlqiqsdtgvaatlkefkerlagdkyqaavqalreevesfaslfplpgl