PDB entry 1bj3

View 1bj3 on RCSB PDB site
Description: crystal structure of coagulation factor ix-binding protein (ix-bp) from venom of habu snake with a heterodimer of c-type lectin domains
Class: collagen binding protein
Keywords: coagulation factor ix-binding, heterodimer, venom, habu snake, c-type lectin superfamily, collagen binding protein
Deposited on 1998-07-02, released 1999-08-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (coagulation factor ix-binding protein a)
    Species: Trimeresurus flavoviridis [TaxId:88087]
    Database cross-references and differences (RAF-indexed):
    • PIR JC4329 (0-128)
    Domains in SCOPe 2.08: d1bj3a_
  • Chain 'B':
    Compound: protein (coagulation factor ix-binding protein b)
    Species: Trimeresurus flavoviridis [TaxId:88087]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bj3b_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bj3A (A:)
    dcpsgwssyeghcykpfklyktwddaerfcteqakgghlvsiesageadfvaqlvteniq
    ntksyvwiglrvqgkekqcssewsdgssvsyenwieaesktclgleketgfrkwvniycg
    qqnpfvcea
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bj3B (B:)
    dcpsdwssyeghcykpfsepknwadaenfctqqhagghlvsfqsseeadfvvklafqtfg
    hsifwmglsnvwnqcnwqwsnaamlrykawaeesycvyfkstnnkwrsracrmmaqfvce
    fqa