PDB entry 1bix

View 1bix on RCSB PDB site
Description: the crystal structure of the human dna repair endonuclease hap1 suggests the recognition of extra-helical deoxyribose at dna abasic sites
Deposited on 1998-06-19, released 1999-06-22
The last revision prior to the SCOP 1.69 freeze date was dated 1999-06-22, with a file datestamp of 1999-06-21.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.184
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1bix__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1bix_ (-)
    kndkeaagegpalyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdi
    lclqetkcsenklpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeeh
    dqegrvivaefdsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdl
    nvaheeidlrnpkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymm
    narsknvgwrldyfllshsllpalcdskirskalgsdhcpitlylal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bix_ (-)
    lyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsenk
    lpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaefd
    sfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnp
    kgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrld
    yfllshsllpalcdskirskalgsdhcpitlylal