PDB entry 1bix

View 1bix on RCSB PDB site
Description: the crystal structure of the human DNA repair endonuclease hap1 suggests the recognition of extra-helical deoxyribose at DNA abasic sites
Class: DNA repair
Keywords: DNA repair, endonuclease, hap1, ref-1, abasic site recognition
Deposited on 1998-06-19, released 1999-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.184
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ap endonuclease 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bixa_
  • Heterogens: SM, PT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bixA (A:)
    kndkeaagegpalyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdi
    lclqetkcsenklpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeeh
    dqegrvivaefdsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdl
    nvaheeidlrnpkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymm
    narsknvgwrldyfllshsllpalcdskirskalgsdhcpitlylal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bixA (A:)
    lyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsenk
    lpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaefd
    sfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnp
    kgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrld
    yfllshsllpalcdskirskalgsdhcpitlylal