PDB entry 1biw

View 1biw on RCSB PDB site
Description: design and synthesis of conformationally-constrained mmp inhibitors
Deposited on 1998-06-19, released 1999-07-16
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-17, with a file datestamp of 2000-05-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.247
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1biwa_
  • Chain 'B':
    Domains in SCOP 1.55: d1biwb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1biwA (A:)
    frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
    misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
    ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1biwB (B:)
    frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
    misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
    ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdspet