PDB entry 1biu

View 1biu on RCSB PDB site
Description: hiv-1 integrase core domain complexed with mg++
Class: DNA integration
Keywords: DNA integration, integrase, hiv, hydrolase, aspartyl protease, endonuclease
Deposited on 1998-06-19, released 1998-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.198
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 integrase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497
      • engineered (84)
      • conflict (86)
      • engineered (138)
    Domains in SCOPe 2.07: d1biua_
  • Chain 'B':
    Compound: hiv-1 integrase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497
      • engineered (84)
      • conflict (86)
      • engineered (138)
    Domains in SCOPe 2.07: d1biub_
  • Chain 'C':
    Compound: hiv-1 integrase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497
      • engineered (84)
      • conflict (86)
      • engineered (138)
    Domains in SCOPe 2.07: d1biuc_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1biuA (A:)
    gshmhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklag
    rwpvktvhtdngsnftsttvkaacewggikqefgipynpqsqgviesmnkelkkiigqvr
    dqaehlktavqmavfihnkkrkggiggysagerivdiiatdiqtke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1biuA (A:)
    cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
    dngsnftsttvkaacewggikqefgqgviesmnkelkkiigqvrdqaehlktavqmavfi
    hnkkrkggiggysagerivdiiatdiq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1biuB (B:)
    gshmhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklag
    rwpvktvhtdngsnftsttvkaacewggikqefgipynpqsqgviesmnkelkkiigqvr
    dqaehlktavqmavfihnkkrkggiggysagerivdiiatdiqtke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1biuB (B:)
    cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
    dngsnftsttvkaacewggikqefggviesmnkelkkiigqvrdqaehlktavqmavfih
    nkkrkggiggysagerivdiiatdiq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1biuC (C:)
    gshmhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklag
    rwpvktvhtdngsnftsttvkaacewggikqefgipynpqsqgviesmnkelkkiigqvr
    dqaehlktavqmavfihnkkrkggiggysagerivdiiatdiqtke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1biuC (C:)
    cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
    dngsnftsttvkaacewggikqefggviesmnkelkkiigqvrdqaehlktavqmavfih
    nkkrkggiggysagerivdiiatdiq