PDB entry 1bit

View 1bit on RCSB PDB site
Description: the crystal structure of anionic salmon trypsin in a second crystal form
Class: serine proteinase
Keywords: serine proteinase
Deposited on 1994-08-26, released 1994-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.199
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: Salmo salar [TaxId:8030]
    Database cross-references and differences (RAF-indexed):
    • PIR S31776 (Start-236)
    Domains in SCOPe 2.07: d1bita_
  • Heterogens: CA, SO4, BEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bitA (A:)
    fvlligaafateddkivggyeckaysqahqvslnsgyhfcggslvnenwvvsaahcyksr
    vevrlgehnikvtegseqfisssrvirhpnyssynidndimliklskpatlntyvqpval
    ptscapagtmctvsgwgntmsstadsnklqclnipilsysdcnnsypgmitnamfcagyl
    eggkdscqgdsggpvvcngelqgvvswgygcaepgnpgvyakvcifndwltstmasy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bitA (A:)
    ivggyeckaysqahqvslnsgyhfcggslvnenwvvsaahcyksrvevrlgehnikvteg
    seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalptscapagtmctvsg
    wgntmsstadsnklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv
    vcngelqgvvswgygcaepgnpgvyakvcifndwltstmasy