PDB entry 1bir
View 1bir on RCSB PDB site
Description: ribonuclease t1, phe 100 to ala mutant complexed with 2' gmp
Class: endoribonuclease
Keywords: hydrolase, nuclease, endoribonuclease
Deposited on
1996-01-04, released
1996-08-17
The last revision prior to the SCOPe 2.08 freeze date was dated
2018-03-21, with a file datestamp of
2018-03-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: ribonuclease t1
Species: Aspergillus oryzae [TaxId:5062]
Gene: synthetic gene
Database cross-references and differences (RAF-indexed):
- Uniprot P00651 (0-103)
- conflict (24)
- engineered (99)
Domains in SCOPe 2.08: d1bira_ - Chain 'B':
Compound: ribonuclease t1
Species: Aspergillus oryzae [TaxId:5062]
Gene: synthetic gene
Database cross-references and differences (RAF-indexed):
- Uniprot P00651 (0-103)
- conflict (24)
- engineered (99)
Domains in SCOPe 2.08: d1birb_ - Heterogens: CA, 2GP, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1birA (A:)
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnavect
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1birB (B:)
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnavect