PDB entry 1bip

View 1bip on RCSB PDB site
Description: bifunctional proteinase inhibitor trypsin/a-amylase from seeds of ragi (eleusine coracana gaertneri)
Class: serine proteinase inhibitor
Keywords: serine proteinase inhibitor
Deposited on 1995-03-31, released 1995-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: alpha-amylase/trypsin inhibitor
  Species: Eleusine coracana [TaxId:4511]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01087 (0-121)
    • conflict (69)
  Domains in SCOPe 2.08: d1bipa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bipA (A:)
  svgtscipgmaiphnpldscrwyvstrtcgvgprlatqemkarccrqleaipaycrceav
  rilmdgvvtssgqhegrllqdlpgcprqvqrafapklvtevecnlatihggpfclsllga
  ge