PDB entry 1bio

View 1bio on RCSB PDB site
Description: human complement factor d in complex with isatoic anhydride inhibitor
Class: serine protease
Keywords: serine protease, hydrolase, complement, factor d, catalytic triad, self-regulation
Deposited on 1998-06-18, released 1999-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.186
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: complement factor d
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bioa_
  • Heterogens: SOA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bioA (A:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
    sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
    tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
    gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla