PDB entry 1bin

View 1bin on RCSB PDB site
Description: leghemoglobin a (acetomet)
Deposited on 1996-08-23, released 1997-03-12
The last revision prior to the SCOP 1.71 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1bina_
  • Chain 'B':
    Domains in SCOP 1.71: d1binb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1binA (A:)
    vaftekqdalvsssfeafkanipqysvvfytsilekapaakdlfsflangvdptnpkltg
    haeklfalvrdsagqlkasgtvvadaalgsvhaqkavtdpqfvvvkeallktikaavgdk
    wsdelsrawevaydelaaaikka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1binB (B:)
    vaftekqdalvsssfeafkanipqysvvfytsilekapaakdlfsflangvdptnpkltg
    haeklfalvrdsagqlkasgtvvadaalgsvhaqkavtdpqfvvvkeallktikaavgdk
    wsdelsrawevaydelaaaikka