PDB entry 1bim

View 1bim on RCSB PDB site
Description: crystallographic studies on the binding modes of p2-p3 butanediamide renin inhibitors
Class: aspartic proteinase
Keywords: aspartic proteinase
Deposited on 1995-09-27, released 1996-01-29
The last revision prior to the SCOP 1.73 freeze date was dated 1996-01-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.178
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: renin
    Species: HOMO SAPIENS
    Gene: CMV IE-HUMAN PREPRORENIN CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1bima_
  • Chain 'B':
    Compound: renin
    Species: HOMO SAPIENS
    Gene: CMV IE-HUMAN PREPRORENIN CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1bimb_
  • Heterogens: DMF, PHC, HII, IP4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bimA (A:)
    gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhkl
    fdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlae
    fdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlggsdp
    qhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklm
    ealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaiham
    dippptgptwalgatfirkfytefdrrnnrigfalar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bimA (A:)
    gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhkl
    fdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlae
    fdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdseslggqivlggsdpqhy
    egnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklmeal
    gakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaihamdip
    pptgptwalgatfirkfytefdrrnnrigfalar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bimB (B:)
    gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhkl
    fdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlae
    fdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlggsdp
    qhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklm
    ealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaiham
    dippptgptwalgatfirkfytefdrrnnrigfalar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bimB (B:)
    gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhkl
    fdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlae
    fdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsslggqivlggsdpqhye
    gnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklmealg
    akkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaihamdipp
    ptgptwalgatfirkfytefdrrnnrigfalar