PDB entry 1bim

View 1bim on RCSB PDB site
Description: crystallographic studies on the binding modes of p2-p3 butanediamide renin inhibitors
Class: hydrolase/hydrolase inhibitor
Keywords: ASPARTIC PROTEINASE, Aspartyl protease, Cleavage on pair of basic residues, Disease mutation, Disulfide bond, Glycoprotein, Hydrolase, Membrane, Protease, Secreted, Zymogen, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 1995-09-27, released 1996-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-18, with a file datestamp of 2012-01-13.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.178
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: renin
    Species: Homo sapiens [TaxId:9606]
    Gene: CMV IE-HUMAN PREPRORENIN CDNA, REN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bima_
  • Chain 'B':
    Compound: renin
    Species: Homo sapiens [TaxId:9606]
    Gene: CMV IE-HUMAN PREPRORENIN CDNA, REN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bimb_
  • Heterogens: 0QB

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bimA (A:)
    gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhkl
    fdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlae
    fdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlggsdp
    qhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklm
    ealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaiham
    dippptgptwalgatfirkfytefdrrnnrigfalar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bimA (A:)
    gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhkl
    fdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlae
    fdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdseslggqivlggsdpqhy
    egnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklmeal
    gakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaihamdip
    pptgptwalgatfirkfytefdrrnnrigfalar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bimB (B:)
    gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhkl
    fdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlae
    fdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlggsdp
    qhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklm
    ealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaiham
    dippptgptwalgatfirkfytefdrrnnrigfalar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bimB (B:)
    gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhkl
    fdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlae
    fdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsslggqivlggsdpqhye
    gnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklmealg
    akkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaihamdipp
    ptgptwalgatfirkfytefdrrnnrigfalar