PDB entry 1bil

View 1bil on RCSB PDB site
Description: crystallographic studies on the binding modes of p2-p3 butanediamide renin inhibitors
Deposited on 1995-09-27, released 1996-01-29
The last revision prior to the SCOP 1.57 freeze date was dated 1996-01-29, with a file datestamp of 1996-01-31.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.17
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1bila_
  • Chain 'B':
    Domains in SCOP 1.57: d1bilb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bilA (A:)
    gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhkl
    fdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlae
    fdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlggsdp
    qhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklm
    ealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaiham
    dippptgptwalgatfirkfytefdrrnnrigfalar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bilA (A:)
    gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhkl
    fdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlae
    fdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdseslggqivlggsdpqhy
    egnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklmeal
    gakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaihamdip
    pptgptwalgatfirkfytefdrrnnrigfalar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bilB (B:)
    gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhkl
    fdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlae
    fdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlggsdp
    qhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklm
    ealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaiham
    dippptgptwalgatfirkfytefdrrnnrigfalar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bilB (B:)
    gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhkl
    fdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlae
    fdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsslggqivlggsdpqhye
    gnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklmealg
    akkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaihamdipp
    ptgptwalgatfirkfytefdrrnnrigfalar