PDB entry 1bik

View 1bik on RCSB PDB site
Description: x-ray structure of bikunin from the human inter-alpha-inhibitor complex
Class: glycoprotein
Keywords: glycoprotein, bikunin, trypstatin, urinary trypsin inhibitor, uronic-acid-rich protein, serine protease inhibitor (kunitz type), glycosylated protein
Deposited on 1997-11-26, released 1999-03-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bikunin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bika1, d1bika2
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bikA (A:)
    avlpqeeegsgggqlvtevtkkedscqlgysagpcmgmtsryfyngtsmacetfqyggcm
    gngnnfvtekeclqtcrtvaacnlpivrgpcrafiqlwafdavkgkcvlfpyggcqgngn
    kfysekecreycgvpgdgdeellrfsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bikA (A:)
    scqlgysagpcmgmtsryfyngtsmacetfqyggcmgngnnfvtekeclqtcrtvaacnl
    pivrgpcrafiqlwafdavkgkcvlfpyggcqgngnkfysekecreycgv