PDB entry 1bih

View 1bih on RCSB PDB site
Description: crystal structure of the insect immune protein hemolin: a new domain arrangement with implications for homophilic adhesion
Class: insect immunity
Keywords: insect immunity, lps-binding, homophilic adhesion
Deposited on 1998-06-17, released 1998-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.218
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bihA (A:)
    lpvdkypvlkdqpaevlfrennptvleciiegndqgvkyswkkdgksynwqehnaalrkd
    egslvflrpqasdeghyqcfaetpagvassrvisfrktyliaspakthektpiegrpfql
    dcvlpnaypkplitwkkrlsgadpnadvtdfdrritagpdgnlyftivtkedvsdiykyv
    ctaknaavdeevvlveyeikgvtkdnsgykgepvpqyvskdmmakagdvtmiycmygsnp
    mgypnyfkngkdvngnpedritrhnrtsgkrllfkttlpedegvytcevdngvgkpqkhs
    lkltvvsapkyeqkpekvivvkqgqdvtipckvtglpapnvvwshnakplsggratvtds
    glvikgvkngdkgyygcratnehgdkyfetlvqvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bihA (A:)
    kypvlkdqpaevlfrennptvleciiegndqgvkyswkkdgksynwqehnaalrkdegsl
    vflrpqasdeghyqcfaetpagvassrvisfrktyliaspakthektpiegrpfqldcvl
    pnaypkplitwkkrlsgadpnadvtdfdrritagpdgnlyftivtkedvsdiykyvctak
    naavdeevvlveyeikgvtkdnsgykgepvpqyvskdmmakagdvtmiycmygsnpmgyp
    nyfkngkdvngnpedritrhnrtsgkrllfkttlpedegvytcevdngvgkpqkhslklt
    vvsapkyeqkpekvivvkqgqdvtipckvtglpapnvvwshnakplsggratvtdsglvi
    kgvkngdkgyygcratnehgdkyfetlvqvn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bihB (B:)
    lpvdkypvlkdqpaevlfrennptvleciiegndqgvkyswkkdgksynwqehnaalrkd
    egslvflrpqasdeghyqcfaetpagvassrvisfrktyliaspakthektpiegrpfql
    dcvlpnaypkplitwkkrlsgadpnadvtdfdrritagpdgnlyftivtkedvsdiykyv
    ctaknaavdeevvlveyeikgvtkdnsgykgepvpqyvskdmmakagdvtmiycmygsnp
    mgypnyfkngkdvngnpedritrhnrtsgkrllfkttlpedegvytcevdngvgkpqkhs
    lkltvvsapkyeqkpekvivvkqgqdvtipckvtglpapnvvwshnakplsggratvtds
    glvikgvkngdkgyygcratnehgdkyfetlvqvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bihB (B:)
    kypvlkdqpaevlfrennptvleciiegndqgvkyswkkdgksynwqehnaalrkdegsl
    vflrpqasdeghyqcfaetpagvassrvisfrktyliaspakthektpiegrpfqldcvl
    pnaypkplitwkkrlsgadpnadvtdfdrritagpdgnlyftivtkedvsdiykyvctak
    naavdeevvlveyeikgvtkdnsgykgepvpqyvskdmmakagdvtmiycmygsnpmgyp
    nyfkngkdvngnpedritrhnrtsgkrllfkttlpedegvytcevdngvgkpqkhslklt
    vvsapkyeqkpekvivvkqgqdvtipckvtglpapnvvwshnakplsggratvtdsglvi
    kgvkngdkgyygcratnehgdkyfetlvqvn