PDB entry 1big

View 1big on RCSB PDB site
Description: scorpion toxin bmtx1 from buthus martensii karsch, nmr, 25 structures
Class: neurotoxin
Keywords: toxin, scorpion, neurotoxin, large conductance potassium channel, voltage gated potassium channel, buthus martensii
Deposited on 1998-06-16, released 1999-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: toxin bmtx1
    Species: Mesobuthus martensii [TaxId:34649]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1biga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bigA (A:)
    eftdvkctgskqcwpvckqmfgkpngkcmngkcrcys