PDB entry 1bid

View 1bid on RCSB PDB site
Description: e. coli thymidylate synthase complexed with dump
Class: methyltransferase
Keywords: transferase (methyltransferase), substrate modules, methyltransferase
Deposited on 1997-06-27, released 1998-07-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.172
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidylate synthase
    Species: Escherichia coli [TaxId:562]
    Gene: thyA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bida_
  • Heterogens: UMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bidA (A:)
    mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
    wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
    ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
    yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
    dyrfedfeiegydphpgikapvai