PDB entry 1bib

View 1bib on RCSB PDB site
Description: the e. coli biotin holoenzyme synthetase(slash)bio repressor crystal structure delineates the biotin and DNA-binding domains
Class: transcription regulation
Keywords: transcription regulation
Deposited on 1992-07-06, released 1993-10-31
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.173
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bir a
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1biba1, d1biba2, d1biba3
  • Heterogens: BTN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bibA (A:)
    mkdntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgysl
    pepiqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrg
    rkwfspfganlylsmfwrleqgpaaaiglslvigivmaevlrklgadkvrvkwpndlylq
    drklagilveltgktgdaaqivigaginmamrrveesvvnqgwitlqeaginldrntlaa
    mlirelraalelfeqeglapylsrwekldnfinrpvkliigdkeifgisrgidkqgalll
    eqdgiikpwmggeislrsaek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bibA (A:)
    kdntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgyslp
    epiqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrspf
    ganlylsmfwrleqpaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrklagil
    veltgaaqivigaginmamwitlqeaginldrntlaamlirelraalelfeqeglapyls
    rwekldnfinrpvkliigdkeifgisrgidkqgallleqdgiikpwmggeislr