PDB entry 1bib

View 1bib on RCSB PDB site
Description: the e. coli biotin holoenzyme synthetase(slash)bio repressor crystal structure delineates the biotin and dna-binding domains
Deposited on 1992-07-06, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.173
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1bib_ (-)
    kdntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgyslp
    epiqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrgr
    kwfspfganlylsmfwrleqgpaaaiglslvigivmaevlrklgadkvrvkwpndlylqd
    rklagilveltgktgdaaqivigaginmamrrveesvvnqgwitlqeaginldrntlaam
    lirelraalelfeqeglapylsrwekldnfinrpvkliigdkeifgisrgidkqgallle
    qdgiikpwmggeislr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bib_ (-)
    kdntvplkliallangefhsgeqlgetlgmsraainkhiqtlrdwgvdvftvpgkgyslp
    epiqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrspf
    ganlylsmfwrleqpaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrklagil
    veltgaaqivigaginmamwitlqeaginldrntlaamlirelraalelfeqeglapyls
    rwekldnfinrpvkliigdkeifgisrgidkqgallleqdgiikpwmggeislr