PDB entry 1bi9

View 1bi9 on RCSB PDB site
Description: retinal dehydrogenase type two with nad bound
Class: aldehyde dehydrogenase
Keywords: aldehyde dehydrogenase, retinoid
Deposited on 1998-06-23, released 1999-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.234
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: retinal dehydrogenase type II
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bi9a_
  • Chain 'B':
    Compound: retinal dehydrogenase type II
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bi9b_
  • Chain 'C':
    Compound: retinal dehydrogenase type II
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bi9c_
  • Chain 'D':
    Compound: retinal dehydrogenase type II
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bi9d_
  • Heterogens: CL, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bi9A (A:)
    maslqllpsptpnleikytkifinnewqnsesgrvfpvcnpatgeqvcevqeadkvdidk
    avqaarlafslgsvwrrmdasergrlldkladlverdratlatmeslnggkpflqafyid
    lqgviktlryyagwadkihgmtipvdgdyftftrhepigvcgqiipwnfpllmftwkiap
    alccgntvvikpaeqtplsalymgalikeagfppgvvnilpgygptagaaiashigidki
    aftgstevgkliqeaagrsnlkrvtlelggkspniifadadldyaveqahqgvffnqgqc
    ctagsrifveesiyeefvkrsverakrrivgspfdptteqgpqidkkqynkileliqsgv
    aegaklecggkglgrkgffieptvfsnvtddmriakeeifgpvqeilrfktmdevieran
    nsdfglvaavftndinkalmvssamqagtvwincynalnaqspfggfkmsgngremgefg
    lreysevktvtvkipqkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bi9A (A:)
    maslqllpsptpnleikytkifinnewqnsesgrvfpvcnpatgeqvcevqeadkvdidk
    avqaarlafslgsvwrrmdasergrlldkladlverdratlatmeslnggkpflqafyid
    lqgviktlryyagwadkihgmtipvdgdyftftrhepigvcgqiipwnfpllmftwkiap
    alccgntvvikpaeqtplsalymgalikeagfppgvvnilpgygptagaaiashigidki
    aftgstevgkliqeaagrsnlkrvtlelggkspniifadadldyaveqahqgvffnqgqc
    ctagsrifveesiyeefvkrsverakrrivgspfdptteqgpqidkkqynkileliqsgv
    aegaklecggkglgrkgffieptvfsnvtddmriakeeifgpvqeilrfktmdevieran
    nsdfglvaavftndinkalmvssamqagtvwincygefglreysevktvtvkipqkns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bi9B (B:)
    maslqllpsptpnleikytkifinnewqnsesgrvfpvcnpatgeqvcevqeadkvdidk
    avqaarlafslgsvwrrmdasergrlldkladlverdratlatmeslnggkpflqafyid
    lqgviktlryyagwadkihgmtipvdgdyftftrhepigvcgqiipwnfpllmftwkiap
    alccgntvvikpaeqtplsalymgalikeagfppgvvnilpgygptagaaiashigidki
    aftgstevgkliqeaagrsnlkrvtlelggkspniifadadldyaveqahqgvffnqgqc
    ctagsrifveesiyeefvkrsverakrrivgspfdptteqgpqidkkqynkileliqsgv
    aegaklecggkglgrkgffieptvfsnvtddmriakeeifgpvqeilrfktmdevieran
    nsdfglvaavftndinkalmvssamqagtvwincynalnaqspfggfkmsgngremgefg
    lreysevktvtvkipqkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bi9B (B:)
    aslqllpsptpnleikytkifinnewqnsesgrvfpvcnpatgeqvcevqeadkvdidka
    vqaarlafslgsvwrrmdasergrlldkladlverdratlatmeslnggkpflqafyidl
    qgviktlryyagwadkihgmtipvdgdyftftrhepigvcgqiipwnfpllmftwkiapa
    lccgntvvikpaeqtplsalymgalikeagfppgvvnilpgygptagaaiashigidkia
    ftgstevgkliqeaagrsnlkrvtlelggkspniifadadldyaveqahqgvffnqgqcc
    tagsrifveesiyeefvkrsverakrrivgspfdptteqgpqidkkqynkileliqsgva
    egaklecggkglgrkgffieptvfsnvtddmriakeeifgpvqeilrfktmdevierann
    sdfglvaavftndinkalmvssamqagtvwincygefglreysevktvtvkipqkns
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bi9C (C:)
    maslqllpsptpnleikytkifinnewqnsesgrvfpvcnpatgeqvcevqeadkvdidk
    avqaarlafslgsvwrrmdasergrlldkladlverdratlatmeslnggkpflqafyid
    lqgviktlryyagwadkihgmtipvdgdyftftrhepigvcgqiipwnfpllmftwkiap
    alccgntvvikpaeqtplsalymgalikeagfppgvvnilpgygptagaaiashigidki
    aftgstevgkliqeaagrsnlkrvtlelggkspniifadadldyaveqahqgvffnqgqc
    ctagsrifveesiyeefvkrsverakrrivgspfdptteqgpqidkkqynkileliqsgv
    aegaklecggkglgrkgffieptvfsnvtddmriakeeifgpvqeilrfktmdevieran
    nsdfglvaavftndinkalmvssamqagtvwincynalnaqspfggfkmsgngremgefg
    lreysevktvtvkipqkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bi9C (C:)
    maslqllpsptpnleikytkifinnewqnsesgrvfpvcnpatgeqvcevqeadkvdidk
    avqaarlafslgsvwrrmdasergrlldkladlverdratlatmeslnggkpflqafyid
    lqgviktlryyagwadkihgmtipvdgdyftftrhepigvcgqiipwnfpllmftwkiap
    alccgntvvikpaeqtplsalymgalikeagfppgvvnilpgygptagaaiashigidki
    aftgstevgkliqeaagrsnlkrvtlelggkspniifadadldyaveqahqgvffnqgqc
    ctagsrifveesiyeefvkrsverakrrivgspfdptteqgpqidkkqynkileliqsgv
    aegaklecggkglgrkgffieptvfsnvtddmriakeeifgpvqeilrfktmdevieran
    nsdfglvaavftndinkalmvssamqagtvwincynagefglreysevktvtvkipqkns
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1bi9D (D:)
    maslqllpsptpnleikytkifinnewqnsesgrvfpvcnpatgeqvcevqeadkvdidk
    avqaarlafslgsvwrrmdasergrlldkladlverdratlatmeslnggkpflqafyid
    lqgviktlryyagwadkihgmtipvdgdyftftrhepigvcgqiipwnfpllmftwkiap
    alccgntvvikpaeqtplsalymgalikeagfppgvvnilpgygptagaaiashigidki
    aftgstevgkliqeaagrsnlkrvtlelggkspniifadadldyaveqahqgvffnqgqc
    ctagsrifveesiyeefvkrsverakrrivgspfdptteqgpqidkkqynkileliqsgv
    aegaklecggkglgrkgffieptvfsnvtddmriakeeifgpvqeilrfktmdevieran
    nsdfglvaavftndinkalmvssamqagtvwincynalnaqspfggfkmsgngremgefg
    lreysevktvtvkipqkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bi9D (D:)
    maslqllpsptpnleikytkifinnewqnsesgrvfpvcnpatgeqvcevqeadkvdidk
    avqaarlafslgsvwrrmdasergrlldkladlverdratlatmeslnggkpflqafyid
    lqgviktlryyagwadkihgmtipvdgdyftftrhepigvcgqiipwnfpllmftwkiap
    alccgntvvikpaeqtplsalymgalikeagfppgvvnilpgygptagaaiashigidki
    aftgstevgkliqeaagrsnlkrvtlelggkspniifadadldyaveqahqgvffnqgqc
    ctagsrifveesiyeefvkrsverakrrivgspfdptteqgpqidkkqynkileliqsgv
    aegaklecggkglgrkgffieptvfsnvtddmriakeeifgpvqeilrfktmdevieran
    nsdfglvaavftndinkalmvssamqagtvwincynalngefglreysevktvtvkipqk
    ns