PDB entry 1bi7

View 1bi7 on RCSB PDB site
Description: mechanism of g1 cyclin dependent kinase inhibition from the structure of the cdk6-p16ink4a tumor suppressor complex
Class: complex (kinase/anti-oncogene)
Keywords: cyclin dependent kinase, cyclin dependent kinase inhibitory protein, cdk, ink4, cell cycle, multiple tumor suppressor, mts1, complex (kinase/anti-oncogene)
Deposited on 1998-06-22, released 1999-01-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: 0.227
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-dependent kinase 6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1bi7a_
  • Chain 'B':
    Compound: multiple tumor suppressor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42771
      • conflict (36)
    Domains in SCOPe 2.06: d1bi7b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bi7A (A:)
    mekdglcradqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstir
    evavlrhletfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvpte
    tikdmmfqllrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvv
    vtlwyrapevllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpge
    edwprdvalprqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyf
    qdlerckenldshlppsqntselnta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bi7A (A:)
    dqqyecvaeigegaygkvfkardlknggrfvalkrvrvqehpnvvrlfdvctvsrtdret
    kltlvfehvdqdlttyldkvpepgvptetikdmmfqllrgldflhshrvvhrdlkpqnil
    vtssgqikladfglariysfqmaltsvvvtlwyrapevllqssyatpvdlwsvgcifaem
    frrkplfrgssdvdqlgkildviglpgeedwprdvalprqafhsksaqpiekfvtdidel
    gkdlllkcltfnpakrisaysalshpyfq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bi7B (B:)
    mepaagssmepsadwlataaargrveevralleaganpnapnsygrrpiqvmmmgsarva
    ellllhgaepncadpatltrpvhdaaregfldtlvvlhragarldvrdawgrlpvdlaee
    lghrdvarylraaaggtrgsnharidaaegpsdipd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bi7B (B:)
    epsadwlataaargrveevralleaganpnapnsygrrpiqvmmmgsarvaellllhgae
    pncadpatltrpvhdaaregfldtlvvlhragarldvrdawgrlpvdlaeelghrdvary
    lraaa