PDB entry 1bi6

View 1bi6 on RCSB PDB site
Description: nmr structure of bromelain inhibitor vi from pineapple stem
Class: cysteine protease inhibitor
Keywords: cysteine protease inhibitor
Deposited on 1995-12-07, released 1996-04-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'H':
  Compound: bromelain inhibitor vi
  Species: Ananas comosus [TaxId:4615]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P27478 (0-40)
  Domains in SCOPe 2.08: d1bi6.2, d1bi6h1
• Chain 'L':
  Compound: bromelain inhibitor vi
  Species: Ananas comosus [TaxId:4615]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P27478 (0-10)
  Domains in SCOPe 2.08: d1bi6.2

PDB Chain Sequences:

• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bi6H (H:)
  eeykcyctdtysdcpgfcktckaefgkyicldlispndcvk
  

  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bi6L (L:)
  tacsecvcplr