PDB entry 1bhy

View 1bhy on RCSB PDB site
Description: low temperature middle resolution structure of p64k from masc data
Deposited on 1998-06-10, released 1998-11-04
The last revision prior to the SCOP 1.57 freeze date was dated 1998-11-18, with a file datestamp of 1998-11-18.
Experiment type: XRAY
Resolution: 4.18 Å
R-factor: 0.338
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bhy_ (-)
    gsadaeydvvvlgggpggysaafaaadeglkvaiveryktlggvclnvgcipskallhna
    avidevrhlaangikypepeldidmlraykdgvvsrltgglagmaksrkvdviqgdgqfl
    dphhlevsltagdayeqaaptgekkivafknciiaagsrvtklpfipedpriidssgala
    lkevpgklliigggiiglemgtvystlgsrldvvemmdglmqgadrdlvkvwqkqneyrf
    dnimvntktvavepkedgvyvtfeganapkepqrydavlvaagrapngklisaekagvav
    tdrgfievdkqmrtnvphiyaigdivgqpmlahkavheghvaaencaghkayfdarvipg
    vaytspevawvgetelsakasarkitkanfpwaasgraiangcdkpftklifdaetgrii
    gggivgpnggdmigevylaiemgcdaadigktihphptlgesigmaaevalgtctdlppq
    kk