PDB entry 1bhx

View 1bhx on RCSB PDB site
Description: x-ray structure of the complex of human alpha thrombin with the inhibitor sdz 229-357
Class: serine protease
Keywords: serine protease
Deposited on 1998-06-10, released 1998-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha thrombin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bhx.1
  • Chain 'B':
    Compound: alpha thrombin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bhx.1
  • Chain 'E':
    Compound: alpha thrombin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1BHX (0-4)
  • Chain 'F':
    Compound: alpha thrombin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bhx.1
  • Heterogens: R56, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bhxA (A:)
sgeadcglrplfekksledkterellesyi

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bhxB (B:)
ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
pdretaasllqagykgrvtgwgnlket

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bhxF (F:)
gqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvmksp
fnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge