PDB entry 1bhw

View 1bhw on RCSB PDB site
Description: low temperature middle resolution structure of xylose isomerase from masc data
Class: isomerase
Keywords: isomerase, masc, multiwavelength anomalous solvent contrast
Deposited on 1998-06-10, released 1998-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 4.1 Å
R-factor: 0.315
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylose isomerase
    Species: Actinoplanes missouriensis [TaxId:1866]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12851 (Start-392)
      • conflict (218)
    Domains in SCOPe 2.07: d1bhwa_
  • Chain 'B':
    Compound: xylose isomerase
    Species: Actinoplanes missouriensis [TaxId:1866]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12851 (Start-392)
      • conflict (218)
    Domains in SCOPe 2.07: d1bhwb_
  • Chain 'C':
    Compound: xylose isomerase
    Species: Actinoplanes missouriensis [TaxId:1866]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12851 (Start-392)
      • conflict (218)
    Domains in SCOPe 2.07: d1bhwc_
  • Chain 'D':
    Compound: xylose isomerase
    Species: Actinoplanes missouriensis [TaxId:1866]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12851 (Start-392)
      • conflict (218)
    Domains in SCOPe 2.07: d1bhwd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bhwA (A:)
    svqatredkfsfglwtvgwqardafgdatrtaldpveavhklaeigaygitfhdddlvpf
    gsdaqtrdgiiagfkkaldetglivpmvttnlfthpvfkdggftsndrsvrryairkvlr
    qmdlgaelgaktlvlwggregaeydsakdvsaaldryrealnllaqysedrgyglrfaie
    pkpneprgdillptaghaiafvqelerpelfginpetgneqmsnlnftqgiaqalwhkkl
    fhidlngqhgpkfdqdlvfghgdllnafslvdllengpdgapaydgprhfdykpsrtedy
    dgvwesakanirmylllkerakafradpevqealaaskvaelktptlnpgegyaelladr
    safedydadavgakgfgfvklnqlaiehllgar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bhwA (A:)
    vqatredkfsfglwtvgwqardafgdatrtaldpveavhklaeigaygitfhdddlvpfg
    sdaqtrdgiiagfkkaldetglivpmvttnlfthpvfkdggftsndrsvrryairkvlrq
    mdlgaelgaktlvlwggregaeydsakdvsaaldryrealnllaqysedrgyglrfaiep
    kpneprgdillptaghaiafvqelerpelfginpetgneqmsnlnftqgiaqalwhkklf
    hidlngqhgpkfdqdlvfghgdllnafslvdllengpdgapaydgprhfdykpsrtedyd
    gvwesakanirmylllkerakafradpevqealaaskvaelktptlnpgegyaelladrs
    afedydadavgakgfgfvklnqlaiehllgar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bhwB (B:)
    svqatredkfsfglwtvgwqardafgdatrtaldpveavhklaeigaygitfhdddlvpf
    gsdaqtrdgiiagfkkaldetglivpmvttnlfthpvfkdggftsndrsvrryairkvlr
    qmdlgaelgaktlvlwggregaeydsakdvsaaldryrealnllaqysedrgyglrfaie
    pkpneprgdillptaghaiafvqelerpelfginpetgneqmsnlnftqgiaqalwhkkl
    fhidlngqhgpkfdqdlvfghgdllnafslvdllengpdgapaydgprhfdykpsrtedy
    dgvwesakanirmylllkerakafradpevqealaaskvaelktptlnpgegyaelladr
    safedydadavgakgfgfvklnqlaiehllgar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bhwB (B:)
    vqatredkfsfglwtvgwqardafgdatrtaldpveavhklaeigaygitfhdddlvpfg
    sdaqtrdgiiagfkkaldetglivpmvttnlfthpvfkdggftsndrsvrryairkvlrq
    mdlgaelgaktlvlwggregaeydsakdvsaaldryrealnllaqysedrgyglrfaiep
    kpneprgdillptaghaiafvqelerpelfginpetgneqmsnlnftqgiaqalwhkklf
    hidlngqhgpkfdqdlvfghgdllnafslvdllengpdgapaydgprhfdykpsrtedyd
    gvwesakanirmylllkerakafradpevqealaaskvaelktptlnpgegyaelladrs
    afedydadavgakgfgfvklnqlaiehllgar
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bhwC (C:)
    svqatredkfsfglwtvgwqardafgdatrtaldpveavhklaeigaygitfhdddlvpf
    gsdaqtrdgiiagfkkaldetglivpmvttnlfthpvfkdggftsndrsvrryairkvlr
    qmdlgaelgaktlvlwggregaeydsakdvsaaldryrealnllaqysedrgyglrfaie
    pkpneprgdillptaghaiafvqelerpelfginpetgneqmsnlnftqgiaqalwhkkl
    fhidlngqhgpkfdqdlvfghgdllnafslvdllengpdgapaydgprhfdykpsrtedy
    dgvwesakanirmylllkerakafradpevqealaaskvaelktptlnpgegyaelladr
    safedydadavgakgfgfvklnqlaiehllgar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bhwC (C:)
    vqatredkfsfglwtvgwqardafgdatrtaldpveavhklaeigaygitfhdddlvpfg
    sdaqtrdgiiagfkkaldetglivpmvttnlfthpvfkdggftsndrsvrryairkvlrq
    mdlgaelgaktlvlwggregaeydsakdvsaaldryrealnllaqysedrgyglrfaiep
    kpneprgdillptaghaiafvqelerpelfginpetgneqmsnlnftqgiaqalwhkklf
    hidlngqhgpkfdqdlvfghgdllnafslvdllengpdgapaydgprhfdykpsrtedyd
    gvwesakanirmylllkerakafradpevqealaaskvaelktptlnpgegyaelladrs
    afedydadavgakgfgfvklnqlaiehllgar
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1bhwD (D:)
    svqatredkfsfglwtvgwqardafgdatrtaldpveavhklaeigaygitfhdddlvpf
    gsdaqtrdgiiagfkkaldetglivpmvttnlfthpvfkdggftsndrsvrryairkvlr
    qmdlgaelgaktlvlwggregaeydsakdvsaaldryrealnllaqysedrgyglrfaie
    pkpneprgdillptaghaiafvqelerpelfginpetgneqmsnlnftqgiaqalwhkkl
    fhidlngqhgpkfdqdlvfghgdllnafslvdllengpdgapaydgprhfdykpsrtedy
    dgvwesakanirmylllkerakafradpevqealaaskvaelktptlnpgegyaelladr
    safedydadavgakgfgfvklnqlaiehllgar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bhwD (D:)
    vqatredkfsfglwtvgwqardafgdatrtaldpveavhklaeigaygitfhdddlvpfg
    sdaqtrdgiiagfkkaldetglivpmvttnlfthpvfkdggftsndrsvrryairkvlrq
    mdlgaelgaktlvlwggregaeydsakdvsaaldryrealnllaqysedrgyglrfaiep
    kpneprgdillptaghaiafvqelerpelfginpetgneqmsnlnftqgiaqalwhkklf
    hidlngqhgpkfdqdlvfghgdllnafslvdllengpdgapaydgprhfdykpsrtedyd
    gvwesakanirmylllkerakafradpevqealaaskvaelktptlnpgegyaelladrs
    afedydadavgakgfgfvklnqlaiehllgar