PDB entry 1bhu

View 1bhu on RCSB PDB site
Description: the 3d structure of the streptomyces metalloproteinase inhibitor, smpi, isolated from streptomyces nigrescens tk-23, nmr, minimized average structure
Class: metalloproteinase inhibitor
Keywords: metalloproteinase inhibitor, signal
Deposited on 1998-06-10, released 1999-01-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: metalloproteinase inhibitor
    Species: Streptomyces nigrescens [TaxId:1920]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bhua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bhuA (A:)
    apscpagslctysgtglsgartvipasdmekagtdgvklpasarsfangthftlrygpar
    kvtcvrfpcyqyatvgkvapgaqlrslpspgatvtvgqdlgd