PDB entry 1bht

View 1bht on RCSB PDB site
Description: nk1 fragment of human hepatocyte growth factor
Deposited on 1998-06-10, released 1998-11-04
The last revision prior to the SCOP 1.55 freeze date was dated 1998-11-18, with a file datestamp of 1998-11-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bhtA (A:)
    rrntihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkark
    qclwfpfnsmssgvkkefghefdlyenkdyirnciigkgrsykgtvsitksgikcqpwss
    miphehsflpssyrgkdlqenycrnprgeeggpwcftsnpevryevcdipqcseve
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bhtB (B:)
    rntihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkarkq
    clwfpfnsmssgvkkefghefdlyenkdyirnciigkgrsykgtvsitksgikcqpwssm
    iphehsflpssyrgkdlqenycrnprgeeggpwcftsnpevryevcdipqcsev