PDB entry 1bht

View 1bht on RCSB PDB site
Description: nk1 fragment of human hepatocyte growth factor
Class: heparin-binding domain
Keywords: heparin-binding domain, kringle, c-met receptor angonist/ antagonist, growth factor
Deposited on 1998-06-10, released 1998-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hepatocyte growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bhta1, d1bhta2
  • Chain 'B':
    Compound: hepatocyte growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bhtb1, d1bhtb2
  • Heterogens: SO4, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bhtA (A:)
    rrntihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkark
    qclwfpfnsmssgvkkefghefdlyenkdyirnciigkgrsykgtvsitksgikcqpwss
    miphehsflpssyrgkdlqenycrnprgeeggpwcftsnpevryevcdipqcseve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bhtB (B:)
    rrntihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkark
    qclwfpfnsmssgvkkefghefdlyenkdyirnciigkgrsykgtvsitksgikcqpwss
    miphehsflpssyrgkdlqenycrnprgeeggpwcftsnpevryevcdipqcseve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bhtB (B:)
    rntihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkarkq
    clwfpfnsmssgvkkefghefdlyenkdyirnciigkgrsykgtvsitksgikcqpwssm
    iphehsflpssyrgkdlqenycrnprgeeggpwcftsnpevryevcdipqcsev