PDB entry 1bhs

View 1bhs on RCSB PDB site
Description: human estrogenic 17beta-hydroxysteroid dehydrogenase
Class: oxidoreductase
Keywords: short-chain dehydrogenase, steroid dehydrogenase, estrogen, human type I 17beta-hsd, human placental 17beta-hsd, oxidoreductase
Deposited on 1995-04-19, released 1996-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.185
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 17beta-hydroxysteroid dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bhsa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bhsA (A:)
    artvvlitgcssgiglhlavrlasdpsqsfkvyatlrdlktqgrlweaaralacppgsle
    tlqldvrdsksvaaarervtegrvdvlvcnaglgllgplealgedavasvldvnvvgtvr
    mlqaflpdmkrrgsgrvlvtgsvgglmglpfndvycaskfaleglceslavlllpfgvhl
    sliecgpvhtafmekvlgspeevldrtdihtfhrfyqylahskqvfreaaqnpeevaevf
    ltalrapkptlryftterflpllrmrlddpsgsnyvtamhrevfgdvpakaeagaeaggg
    agpgaedeagrsavgdpelgdppaapq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bhsA (A:)
    artvvlitgcssgiglhlavrlasdpsqsfkvyatlrdlktqgrlweaaralacppgsle
    tlqldvrdsksvaaarervtegrvdvlvcnaglgllgplealgedavasvldvnvvgtvr
    mlqaflpdmkrrgsgrvlvtgsvgglmglpfndvycaskfaleglceslavlllpfgvhl
    sliecgpvhtafmekvlgspeevldrtdihtfhrfyqylahskqvfreaaqnpeevaevf
    ltalrapkptlryftterflpllrmrlddpsgsnyvtamhrevf